PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00146222001
Common NameGSBRNA2T00146222001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 342aa    MW: 36800.8 Da    PI: 7.998
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00146222001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.8e-3970129362
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++ +kcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk s
  GSBRNA2T00146222001  70 DHPQKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKPS 129
                          6789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3360123IPR003851Zinc finger, Dof-type
PfamPF027011.0E-3271127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.76173127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGLTSLQACM DSDWLQEAES SGGSMLDSTT TSPSAADILA ACSTRPQASA MAVAATAMMD  60
SGRRLRPPHD HPQKCPRCES THTKFCYYNN YSLSQPRYFC KTCRRYWTKG GTLRNIPVGG  120
GCRKNKKPSS SNSPSSKKPS NIVTTDLMAL AHSHQNYQNA SLGFPHFGGN GMMGSYTAPD  180
HSNVGYLESK YGGLLSQSPR PIDFLDSKFD LMGVNNNNLV MVDHGSNGDH HHNLHNNVGG  240
GGLMDISTCQ RLMLSNYDHH LYNHHEDNQR ITSIMDVKPS PKLLSLDWQQ EQGYSEGSGN  300
GGGGRSDGGG YGGGVYINGL GSSWNGLMNG YGSSTKTNSL V*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1302309GGRSDGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00146222001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2289921e-151AK228992.1 Arabidopsis thaliana mRNA for Dof zinc finger protein - like, complete cds, clone: RAFL16-29-O12.
GenBankBT0204671e-151BT020467.1 Arabidopsis thaliana At5g62940 gene, complete cds.
GenBankBT0205761e-151BT020576.1 Arabidopsis thaliana At5g62940 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607164.10.0PREDICTED: dof zinc finger protein DOF5.6-like
SwissprotQ9FM031e-164DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A078DDH10.0A0A078DDH1_BRANA; BnaC09g05850D protein
STRINGBra035873.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-151Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]